PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015867058.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 453aa    MW: 49390.9 Da    PI: 5.6044
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015867058.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS380.61.8e-116914503374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                      lLl+cAe+v+ ++l+ a++lL ++ el+sp g++ +R+ ayf+ AL+ar+ +s+ ++y+ l+ ++ + ++s+++++al+ ++ +sP++kfsh+t
  XP_015867058.1  91 GLLLQCAECVAMDNLNDASELLPEIAELSSPFGSSPERVGAYFAHALQARVISSCLGTYSPLTIKTLTASQSQRTFNALQSYNSISPLVKFSHFT 185
                     58********************************************************************************************* PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                     aNqaI +a++ge+rvH+iD+di+qGlQWp L++ LasR+++  s+R+Tg+gs    s+e le+tg+rLa+fA++lg+pfef++l  k  +  +l+
  XP_015867058.1 186 ANQAIFQALDGEDRVHVIDLDIMQGLQWPGLFHILASRSKKIRSMRVTGFGS----SSELLESTGRRLADFASSLGLPFEFHPLEGKIGSITDLS 276
                     ****************************************************....9**************************988888999*** PP

            GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                     +L v+p Ea++V++++  h l+d ++s       +L+l+  l+Pk++++veq+++h +++Fl rf+eal+yysalfd+l  +l+ +s er++vE+
  XP_015867058.1 277 QLGVRPSEATVVHWMH--HCLYDVTGSDLG----TLRLLSLLRPKLITIVEQDLSH-GGNFLGRFVEALHYYSALFDALGDGLGVDSLERHMVEQ 364
                     ***************9..888888888888....**********************.789*********************************** PP

            GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +l+g ei+n+va  g +r+ + + +e+W + l+++GF+pv+l+ + a+qa+lll +++++gy++ ee+g+l lgWkd +L+++SaW+
  XP_015867058.1 365 QLFGCEIRNIVAVGGPKRTGEVK-VERWGDELKRFGFRPVSLGGNPAAQASLLLGMFPWRGYTLVEENGCLKLGWKDLSLLTASAWQ 450
                     *****************998887.9*************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.20363430IPR005202Transcription factor GRAS
PfamPF035146.4E-11491450IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MLQSLVTQST LNCNRSPNPT SPSSSSSCMK MKRIDRELAG GESSGDDPST KRQNSGRDLT  60
GEATVSGEKT MEDHDEEPVV EGESTGLRLL GLLLQCAECV AMDNLNDASE LLPEIAELSS  120
PFGSSPERVG AYFAHALQAR VISSCLGTYS PLTIKTLTAS QSQRTFNALQ SYNSISPLVK  180
FSHFTANQAI FQALDGEDRV HVIDLDIMQG LQWPGLFHIL ASRSKKIRSM RVTGFGSSSE  240
LLESTGRRLA DFASSLGLPF EFHPLEGKIG SITDLSQLGV RPSEATVVHW MHHCLYDVTG  300
SDLGTLRLLS LLRPKLITIV EQDLSHGGNF LGRFVEALHY YSALFDALGD GLGVDSLERH  360
MVEQQLFGCE IRNIVAVGGP KRTGEVKVER WGDELKRFGF RPVSLGGNPA AQASLLLGMF  420
PWRGYTLVEE NGCLKLGWKD LSLLTASAWQ PSD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-48894504375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015867058.10.0PREDICTED: scarecrow-like protein 23
SwissprotQ9FHZ10.0SCL23_ARATH; Scarecrow-like protein 23
TrEMBLM5WRZ70.0M5WRZ7_PRUPE; Uncharacterized protein
STRINGPOPTR_0016s02030.10.0(Populus trichocarpa)
STRINGGLYMA11G10220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.10.0GRAS family protein